PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.1G007300.4.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 652aa    MW: 73191.1 Da    PI: 7.8248
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.1G007300.4.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding40.65.8e-1375119146
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         + rW++eE ell ++v+++G+++W+ I+  ++  R +  c srw  
  Sevir.1G007300.4.p  75 KCRWSPEENELLTQLVHKHGTKNWHNISCAIP-DRNAHACLSRWKY 119
                         569*****************************.***********85 PP

2Myb_DNA-binding40.75.4e-13127169145
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                         + +W+++E+++l++a++ +G++ W +  ++++ gRt + +k++w+
  Sevir.1G007300.4.p 127 KEAWSQQEELRLIRAHQIYGNK-WCKMVKHFP-GRTNNALKEHWR 169
                         579*******************.*********.***********7 PP

3Myb_DNA-binding40.85e-13334377145
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                         +grW +eE ++l + v+++G ++W tIa+ ++  R + qc+ rw 
  Sevir.1G007300.4.p 334 KGRWLAEENKILTKMVTKHGLKNWQTIASAIP-SRNAQQCRIRWT 377
                         79******************************.***********5 PP

4Myb_DNA-binding36.31.3e-11387428245
                         SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
     Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                           W++eE+++l++a++ +G+  W +  ++++ gRt   +k++w+
  Sevir.1G007300.4.p 387 EDWSEEEELKLIRAHQIYGSQ-WLKMVKHFP-GRTNHALKEHWR 428
                         67*******************.*********.***********7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.17770121IPR017930Myb domain
SuperFamilySSF466893.37E-2573168IPR009057Homeodomain-like
SMARTSM007171.8E-1174123IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.9E-1877128IPR009057Homeodomain-like
CDDcd001675.40E-1077121No hitNo description
PfamPF139215.4E-1478138No hitNo description
PROSITE profilePS5129420.608122176IPR017930Myb domain
SMARTSM007174.3E-13126174IPR001005SANT/Myb domain
CDDcd001671.72E-9129169No hitNo description
Gene3DG3DSA:1.10.10.601.6E-17129176IPR009057Homeodomain-like
PROSITE profilePS5129412.365329380IPR017930Myb domain
SMARTSM007177.9E-12333382IPR001005SANT/Myb domain
SuperFamilySSF466891.69E-23333427IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.6E-20335387IPR009057Homeodomain-like
CDDcd001673.90E-9336380No hitNo description
PfamPF139215.6E-15337397No hitNo description
PROSITE profilePS5129418.766381435IPR017930Myb domain
SMARTSM007178.8E-11385433IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.3E-16388435IPR009057Homeodomain-like
CDDcd001671.30E-8389428No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 652 aa     Download sequence    Send to blast
MEQSSDGMPR QRRDFSSTNH LSNSNAVAEG MTDISHETSK HWQDMESENT EVPPQKKNVH  60
GFNECSSLKN LERTKCRWSP EENELLTQLV HKHGTKNWHN ISCAIPDRNA HACLSRWKYV  120
LDPAINKEAW SQQEELRLIR AHQIYGNKWC KMVKHFPGRT NNALKEHWRG SMKRKLDSYL  180
ASGLLEQVPD LHENLSVLQS SQSDSPKDSK VSSDRSQFSS ILSTRSKLKQ EIRELSENAD  240
TSVGESSDFI YAKALDTHSA KVSESIITKP QQCARARKKL DSVSTPVKLK SDLPPETVKC  300
RQEMESGKTE GPPCKKNGYC FKEGSSLKNS ETTKGRWLAE ENKILTKMVT KHGLKNWQTI  360
ASAIPSRNAQ QCRIRWTRSL DPAINKEDWS EEEELKLIRA HQIYGSQWLK MVKHFPGRTN  420
HALKEHWRGR MKGKLNYYLA SGRLEEITDL KEDISVPESS QSDIPKDSQG SSERNRPPSS  480
LPPRPKSKSD LSELDENADT SEEESSDCIY PKGLDAHSAK VSEKIMAKSK QRARARKKLD  540
FLSTPVELKV CTAAASCQRP PPKMEQTTPA SDNSSPSDVC QGIPQNAASE PVDVVIPTAA  600
SNHPNDVHSL ATPDPCSLEI HEADASDLLD MSYCDGLMID SPLYLHGSSF I*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-21784364110B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012698300.10.0PREDICTED: snRNA-activating protein complex subunit 4-like isoform X1
RefseqXP_004951228.10.0PREDICTED: snRNA-activating protein complex subunit 4-like isoform X1
TrEMBLA0A0A9FY270.0A0A0A9FY27_ARUDO; Uncharacterized protein
STRINGSi017903m0.0(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11510.11e-37myb domain protein 3r-4